| Primary information |
|---|
| ID | 13590 |
| Uniprot ID | A0A0A7DNP6 |
| Description | Prepro-gonadotropin-releasing hormone-like protein (rp-GnRH) [Cleaved into- GnRH dodecapeptide; GnRH-associated peptide (GAP)] |
| Organism | Ruditapes philippinarum |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Spiralia; Lophotrochozoa; Mollusca; Bivalvia; Autobranchia; Heteroconchia; Euheterodonta; Imparidentia; Venerida; Veneroidea; Veneridae (venus clams); Ruditapes; Ruditapes philippinarum (Japanese littleneck clam) (Venerupis philippinarum) |
| Subcellular Location | Secreted |
| Developmental Stage | Expressed in the visceral ganglia at the gonadal early development stage in both sexes. Expressed significantly higher in the female gonad of early development stage (stage 1) than the indifference st |
| Similarity | NA |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Neuropeptide involved in reproduction. May be an important hormone in the regulation of gonadal maturation. |
| Length | 94 |
| Molecular Weight | 10 |
| Name | Prepro-gonadotropin-releasing hormone-like protein |
| Sequence | SYHFSNGWNPGKRSMQEPVCHFRQDVQTLVLKLIEDEVYRMLSDPSCIGGVPTLRNFLKKDLAYTVPLDDKK |
| Sequence map | 23-34 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|