| Primary information |
|---|
| ID | 13576 |
| Uniprot ID | O18979 |
| Description | Neuroendocrine secretory protein 55 (NESP55) [Cleaved into- LSAL tetrapeptide; GAIPIRRH peptide] |
| Organism | Bos taurus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos (oxen; cattle); Bos taurus (Bovine) |
| Subcellular Location | Cytoplasmic vesicle; secretory vesicle. Secreted Note=Neuroendocrine secretory granules. |
| Developmental Stage | NA |
| Similarity | Belongs to the NESP55 family. |
| Tissue Specificity | Highly expressed in adrenal medulla and anterior and posterior pituitary. In the brain; detected in hypothalamus; hippocampus; caudate nucleus; thalamus and; in significantly lower amounts; in the cer |
| Post Translational Modification | Binds keratan sulfate chains. |
| Function | NA |
| Length | 241 |
| Molecular Weight | 27 |
| Name | Neuroendocrine secretory protein 55 |
| Sequence | SSTRAQQRAAAQRRTFLNAHHRSAAQVFPEPPESDHEDTDFEPSLPECPEYQEEEFDYESETESESEIESETEFETESDTAPTTEPETEPEDEPGPVVPKRPTFHQSLTERLSALRLRSPDASPSRAPPSTQESESPRQGEEPEDKDPRDPEESEEPKEEEKQQQHRCKPKKPTRRDPSPESPSKRGAIPIRRH |
| Sequence map | 51-01 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|