Primary information |
---|
ID | 13575 |
Uniprot ID | Q9GLK4 |
Description | Natriuretic peptides B (Brain natriuretic factor prohormone) (preproBNP) (proBNP) (Gamma-brain natriuretic peptide) (Iso-ANP) [Cleaved into- Brain natriuretic peptide 35 (BNP-35); Brain natriuretic peptide 29 (BNP-29)] |
Organism | Felis catus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Carnivora; Feliformia; Felidae (cat family); Felinae; Felis; Felis catus (Cat) (Felis silvestris catus) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the natriuretic peptide family. |
Tissue Specificity | NA |
Post Translational Modification | The precursor molecule is proteolytically cleaved; possibly by FURIN or CORIN; to produce the active peptide. May undergo further proteolytic cleavage by various proteases such as DPP4; MME and possib |
Function | Cardiac hormone that plays a key role in mediating cardio-renal homeostasis. May also function as a paracrine antifibrotic factor in the heart. Acts by specifically binding and stimulating NPR1 to produce cGMP; which in turn activates effector proteins that drive various biological responses. Involved in regulating the extracellular fluid volume and maintaining the fluid-electrolyte balance through natriuresis; diuresis; vasorelaxation; and inhibition of renin and aldosterone secretion. Binds the clearance receptor NPR3. |
Length | 132 |
Molecular Weight | 14 |
Name | Natriuretic peptides B |
Sequence | PLGGPGPASEASAIQELLDGLRDTVSELQEAQMALGPLQQGHSPAESWEAQEEPPARVLAPHDNVLRALRRLGSSKMMRDSRCFGRRLDRIGSLSGLGCNVLRRH |
Sequence map | 29-12 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|