| Primary information |
|---|
| ID | 13568 |
| Uniprot ID | Q07663 |
| Description | Isotocin-neurophysin IT 1 [Cleaved into- Isotocin (IT); Neurophysin IT 1] |
| Organism | Oncorhynchus masou |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Euteleosteomorpha; Protacanthopterygii; Salmoniformes (salmons and trouts); Salmonidae (salmonids); Salmoninae (trouts; salmons & chars); Oncorhynchus; Oncorhynchus masou (Cherry salmon) (Masu salmon) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the vasopressin/oxytocin family. |
| Tissue Specificity | NA |
| Post Translational Modification | Seven disulfide bonds are present in neurophysin. |
| Function | Isotocin causes contraction of smooth muscles. |
| Length | 157 |
| Molecular Weight | 16 |
| Name | Neurophysin IT 1 |
| Sequence | ALAFPSRKCMSCGPGDRGRCFGPNICCGEGMGCYVGSPEAAGCVEENYLPSPCEVGGRVCGSEEGRCAAPGICCDVEGCSIDQSCTEEDEAEYISQSVSSSHGHDLLMKLLNMISHTPPHRVHK |
| Sequence map | 35-37 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|