Primary information |
---|
ID | 13562 |
Uniprot ID | Q02747 |
Description | Guanylin (Guanylate cyclase activator 2A) (Guanylate cyclase-activating protein 1) (Guanylate cyclase-activating protein I) (GCAP-I) [Cleaved into- HMW-guanylin; Guanylin] |
Organism | Homo sapiens |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the guanylin family. |
Tissue Specificity | Highly expressed in ileum and colon. Found in plasma. |
Post Translational Modification | NA |
Function | Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. |
Length | 115 |
Molecular Weight | 12 |
Name | HMW-guanylin |
Sequence | TVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC |
Sequence map | 23-55 |
PDB ID | 1GNA; 1GNB; 1O8R; |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|