| Primary information |
|---|
| ID | 13559 |
| Uniprot ID | P83060 |
| Description | Kininogen-1 (BOK-1) [Cleaved into- Bradykinin] |
| Organism | Bombina orientalis |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amphibia; Batrachia; Anura; Bombinatoridae; Bombina (firebellied toads); Bombina orientalis (Oriental fire-bellied toad) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the bradykinin-related peptide family. |
| Tissue Specificity | Expressed by the skin glands. |
| Post Translational Modification | NA |
| Function | Vasodilator. Bradykinin produces in vitro relaxation of rat arterial smooth muscle and constriction of intestinal smooth muscle. May target bradykinin receptors (BDKRB). |
| Length | 167 |
| Molecular Weight | 19 |
| Name | Kininogen-1 |
| Sequence | ERNVPESEEKTEQFLRDLSEISRLQRRPPGFSPFRGKFHSQSLRDLSEISRLQRRPPGFSPFRGKFHSQSMRDLSEISRLQRRPPGFSPFRGKFHSQSMRDLSEISRLQRRPPGFSPFRGKFHSQSLRGLSEIKRLKTTHKIH |
| Sequence map | 26-47 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|