| Primary information |
|---|
| ID | 13555 |
| Uniprot ID | A5A6J6 |
| Description | Neuroendocrine protein 7B2 (Secretogranin-5) [Cleaved into- N-terminal peptide; C-terminal peptide] |
| Organism | Pan troglodytes |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Pan (chimpanzees); Pan troglodytes (Chimpanzee) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the 7B2 family. |
| Tissue Specificity | NA |
| Post Translational Modification | Proteolytically cleaved in the Golgi by a furin-like convertase to generate bioactive peptides. |
| Function | Acts as a molecular chaperone for PCSK2/PC2; preventing its premature activation in the regulated secretory pathway. Binds to inactive PCSK2 in the endoplasmic reticulum and facilitates its transport from there to later compartments of the secretory pathway where it is proteolytically matured and activated. Also required for cleavage of PCSK2 but does not appear to be involved in its folding. Plays a role in regulating pituitary hormone secretion. The C-terminal peptide inhibits PCSK2 in vitro. |
| Length | 211 |
| Molecular Weight | 23 |
| Name | Neuroendocrine protein 7B2 |
| Sequence | SPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTDDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSVPHFSDEDKDPE |
| Sequence map | 30-31 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|