| Primary information |
|---|
| ID | 13542 |
| Uniprot ID | Q7KUD5 |
| Description | Probable insulin-like peptide 5 (dILP5) (Insulin-related peptide 5) [Cleaved into- Probable insulin-like peptide 5 A chain; Probable insulin-like peptide 5 B chain] |
| Organism | Drosophila melanogaster |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Eremoneura; Cyclorrhapha; Schizophora; Acalyptratae; Ephydroidea; Drosophilidae (pomace flies); Drosophilinae; Drosophilini; Drosophila (fruit flies); Sophophora; melanogaster group; melanogaster subgroup; Drosophila melanogaster (Fruit fly) |
| Subcellular Location | Secreted |
| Developmental Stage | Expressed in the larva but not in the embryo. |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | Expressed at a high level in seven cells of each larval brain hemisphere that may correspond to neurosecretory cells. Expressed at a moderate level in the larval gut. |
| Post Translational Modification | NA |
| Function | NA |
| Length | 108 |
| Molecular Weight | 11 |
| Name | Probable insulin-like peptide 5 |
| Sequence | NSLRACGPALMDMLRVACPNGFNSMFAKRGTLGLFDYEDHLADLDSSESHHMNSLSSIRRDFRGVVDSCCRKSCSFSTLRAYCDS |
| Sequence map | 24-48 |
| PDB ID | 2WFU; 2WFV; 6FEY; |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|