| Primary information |
|---|
| ID | 13538 |
| Uniprot ID | O18330 |
| Description | Major royal jelly protein 1 (MRJP-1) (MRJP1) (56-kDa protein 4) (p56kP-4) (Apalbumin 1) (Apisin subunit MRJP1) (Bee-milk protein) (Royalactin) [Cleaved into- Jellein-1 (Jelleine-I); Jellein-2 (Jelleine-II); Jellein-4 (Jelleine-IV)] |
| Organism | Apis mellifera |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Hymenoptera; Apocrita (wasps; ants; and bees); Aculeata; Apoidea (bees); Apidae (bumble bees and honey bees); Apinae (honey bees); Apini; Apis; Apis mellifera (Honeybee) |
| Subcellular Location | Secreted |
| Developmental Stage | Produced in the cephalic glands of both the nurse bee and the forager bee. This bee milk protein changes to alpha-glucosidase in accordance with the age-dependent role change of the worker bee. |
| Similarity | Belongs to the major royal jelly protein family. |
| Tissue Specificity | Found in the hypopharyngeal glands of the worker honeybee. |
| Post Translational Modification | Glycosylated. |
| Function | [Major royal jelly protein 1]- Induces the differentiation of honeybee larvae into queens through an Egfr-mediated signaling pathway. Promotes body size increase by activating p70 S6 kinase; stimulates ovary development by augmenting the titer of vitellogenin (Vg) and juvenile hormone; and reduces developmental time by increasing the activity of mitogen-activated protein kinase and inducing the 20-hydroxyecdysone protein (20E). Most abundant protein found in the royal jelly which is the food of the queen honey bee larva. The royal jelly determines the development of the young larvae and is responsible for the high reproductive ability of the honeybee queen. |
| Length | 432 |
| Molecular Weight | 48 |
| Name | Major royal jelly protein 1 |
| Sequence | ILRGESLNKSLPILHEWKFFDYDFGSDERRQDAILSGEYDYKNNYPSDIDQWHDKIFVTMLRYNGVPSSLNVISKKVGDGGPLLQPYPDWSFAKYDDCSGIVSASKLAIDKCDRLWVLDSGLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPHDVAVNATTGKGRLSSLAVQSLDCNTNSDTMVYIADEKGEGLIVYHNSDDSFHRLTSNTFDYDPKFTKMTIDGESYTAQDGISGMALSPMTNNLYYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQNILDTQSSAKVVSKSGVLFFGLVGDSALGCWNEHRTLERHNIRTVAQSDETLQMIASMKIKEALPHVPIFDRYINREYILVLSNKMQKMVNNDFNFDDVNFRIMNANVNELILNTRCENPDNDRTPFKISIHL |
| Sequence map | 27-12 |
| PDB ID | 5YYL; 7ASD; |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|