| Primary information |
|---|
| ID | 13525 |
| Uniprot ID | Q9GZV9 |
| Description | Fibroblast growth factor 23 (FGF-23) (Phosphatonin) (Tumor-derived hypophosphatemia-inducing factor) [Cleaved into- Fibroblast growth factor 23 N-terminal peptide; Fibroblast growth factor 23 C-terminal peptide] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the heparin-binding growth factors family. |
| Tissue Specificity | Expressed in osteogenic cells particularly during phases of active bone remodeling. In adult trabecular bone; expressed in osteocytes and flattened bone-lining cells (inactive osteoblasts). |
| Post Translational Modification | Following secretion this protein is inactivated by cleavage into a N-terminal fragment and a C-terminal fragment. The processing is effected by proprotein convertases.; O-glycosylated by GALT3. Glycos |
| Function | Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Upregulates EGR1 expression in the presence of KL. Acts directly on the parathyroid to decrease PTH secretion. Regulator of vitamin-D metabolism. Negatively regulates osteoblast differentiation and matrix mineralization. |
| Length | 251 |
| Molecular Weight | 27 |
| Name | Fibroblast growth factor 23 |
| Sequence | PNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI |
| Sequence map | 29-11 |
| PDB ID | 2P39; 5W21; 6S22; |
| Drugpedia | NA |
| Receptor | Q9UEF7; P11362; P22607; P22455 |
| Domain | NA |
| Pharmaceutical Use | NA
|