| Primary information |
|---|
| ID | 13516 |
| Uniprot ID | P55208 |
| Description | C-type natriuretic peptide prohormone (CNP-115) [Cleaved into- CNP-39; CNP-38; CNP-22] |
| Organism | Triakis scyllium |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Chondrichthyes; Elasmobranchii (elasmobranchs); Selachii (sharks); Galeomorphii; Galeoidea; Carcharhiniformes (ground sharks); Triakidae (houndsharks); Triakis (leopard sharks); Triakis scyllium (Banded houndshark) (Hemigaleus pingi) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the natriuretic peptide family. |
| Tissue Specificity | CNP-115 is differentially processed to produce CNP-38 and CNP-39 in the heart and CNP-22 in the brain. |
| Post Translational Modification | NA |
| Function | Hormone which may be vasoactive and natriuretic. Has a cGMP-stimulating activity. |
| Length | 136 |
| Molecular Weight | 15 |
| Name | C-type natriuretic peptide prohormone |
| Sequence | PRSDDSLQTLSRLLEDEYGHYLPSDELNNEAQEMSPAASLPEFNADQSDLELPWDRESREIGGRPFRQEAVLARLLKDLSNNPLRFRGRSKKGPSRGCFGVKLDRIGAMSGLGC |
| Sequence map | 24-16 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|