| Primary information |
|---|
| ID | 13515 |
| Uniprot ID | A0A4Y5X186 |
| Description | Conopressin/conophysin; isoform 2 [Cleaved into- Conopressin-R; Conophysin] (Fragment) |
| Organism | Conus monile |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Spiralia; Lophotrochozoa; Mollusca; Gastropoda; Caenogastropoda; Neogastropoda; Conoidea; Conidae (cone shells); Conus; Strategoconus; Conus monile (Necklace cone) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the vasopressin/oxytocin family. |
| Tissue Specificity | Expressed by the venom gland. |
| Post Translational Modification | NA |
| Function | Targets vasopressin-oxytocin related receptors. |
| Length | 160 |
| Molecular Weight | 17 |
| Name | Conophysin |
| Sequence | PTRQCMSCGPDGVGQCVGPSVCCGLGLGCLMGTPETEVCQKENESSVPCAISGRHCGMDNTGNCVADGICCVEDACSFNSLCRVDTDQEDSVSARQELLTLIRRLLVNRQYD |
| Sequence map | 50-40 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | The cysteine framework of the conopressin is C-C. |
| Pharmaceutical Use | NA
|