| Primary information |
|---|
| ID | 13502 |
| Uniprot ID | P05486 |
| Description | Conophysin-conopressin [Cleaved into- Conopressin-G (Con-G) (Conopressin-K) (Lys-conopressin-G); Conophysin-G] |
| Organism | Conus geographus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Spiralia; Lophotrochozoa; Mollusca; Gastropoda; Caenogastropoda; Neogastropoda; Conoidea; Conidae (cone shells); Conus; Gastridium; Conus geographus (Geography cone) (Nubecula geographus) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the vasopressin/oxytocin family. |
| Tissue Specificity | Expressed by the venom gland. |
| Post Translational Modification | NA |
| Function | [Conopressin-G]- Targets vasopressin-oxytocin related receptors |
| Length | 128 |
| Molecular Weight | 13 |
| Name | Conophysin-G |
| Sequence | LFKACMSCSFGQCVGPRICCGPRGCEMGTAEANRCIEEDEDPIPCQVVGQHCDLNNPGNIHGNCVANGICCVDDTCTIHTGCL |
| Sequence map | 47-08 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | The cysteine framework of the conopressin is C-C. |
| Pharmaceutical Use | NA
|