Primary information |
---|
ID | 13467 |
Uniprot ID | P23259 |
Description | C-type natriuretic peptide prohormone (CNP-115) [Cleaved into- CNP-39; CNP-38; CNP-22] |
Organism | Scyliorhinus canicula |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Chondrichthyes; Elasmobranchii (elasmobranchs); Selachii (sharks); Galeomorphii; Galeoidea; Carcharhiniformes (ground sharks); Scyliorhinidae (cat sharks); Scyliorhinus; Scyliorhinus canicula (Small-spotted catshark) (Squalus canicula) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the natriuretic peptide family. |
Tissue Specificity | CNP-115 is differentially processed to produce CNP-38 and CNP-39 in the heart and CNP-22 in the brain. |
Post Translational Modification | NA |
Function | Hormone which may be vasoactive and natriuretic. Has a cGMP-stimulating activity. |
Length | 115 |
Molecular Weight | 12 |
Name | C-type natriuretic peptide prohormone |
Sequence | PRSDDSLQTLSRLLEDEYGHYLPSDELNNEAEEMSPAASLPELNADQSDLELPWERESREIGGRPFRQEAVLARLLKDLSNNPLRFRGRSKKGPSRGCFGVKLDRIGAMSGLGC |
Sequence map | 2-55 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|