| Primary information |
|---|
| ID | 13449 |
| Uniprot ID | A0A4Y5X1A7 |
| Description | Conopressin/conophysin; isoform 3 [Cleaved into- Conopressin-K; Conophysin] (Fragment) |
| Organism | Conus monile |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Spiralia; Lophotrochozoa; Mollusca; Gastropoda; Caenogastropoda; Neogastropoda; Conoidea; Conidae (cone shells); Conus; Strategoconus; Conus monile (Necklace cone) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the vasopressin/oxytocin family. |
| Tissue Specificity | Expressed by the venom gland. |
| Post Translational Modification | NA |
| Function | [Conopressin-K]- Targets vasopressin-oxytocin related receptors. Is more active on fish receptors than on their human counterparts; supporting an evolved role of this conopressin in the envenomation process. Acts as an agonist on zebrafish vasopressin receptors V1a1R (EC(50)=10.6 nM); V1a2R (EC(50)=44.06 nM; partial agonist); V2R (EC(50)=299.2 nM) and oxytocin receptor (EC(50)=353.73 nM; partial agonist). Shows a weaker activity on human receptors AVPR1B (EC(50)=51.92 nM); AVPR1A (EC(50)=123.78 nM); AVPR2 (EC(50)=299.2 nM) and oxytocin (OXTR) receptor (EC(50)=455.66 nM; partial agonist). In vivo; exhibits grooming and scratching behavior in mice; following intracerebral injection. |
| Length | 101 |
| Molecular Weight | 10 |
| Name | Conopressin/conophysin; isoform 3 |
| Sequence | FIRNCPKGGKRNVDEGPTKPCMFCSFGQCVAPHTCCGEKGCEMGTVDANMCQEENESPIPCHVFGKRCLLNHPGNSHGNCVTYGICCSHDTCTVHLACM |
| Sequence map | 3-41 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | The cysteine framework of the conopressin is C-C. |
| Pharmaceutical Use | NA
|