| Primary information |
|---|
| ID | 13443 |
| Uniprot ID | A0A291NVT7 |
| Description | Conophysin-conopressin; isoform 1 [Cleaved into- Conopressin-E; Conophysin] (Fragment) |
| Organism | Conus monile |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Spiralia; Lophotrochozoa; Mollusca; Gastropoda; Caenogastropoda; Neogastropoda; Conoidea; Conidae (cone shells); Conus; Strategoconus; Conus monile (Necklace cone) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the vasopressin/oxytocin family. |
| Tissue Specificity | Expressed by the venom gland. |
| Post Translational Modification | NA |
| Function | Targets vasopressin-oxytocin related receptors. |
| Length | 125 |
| Molecular Weight | 13 |
| Name | Conopressin-conophysin; isoform 1 |
| Sequence | FIRNCPEGGKRDVHMIQPTKPCMNCSFGQCVGPRVCCGAGRCEIGSTEADRCEEENEDPVPCKVLGQHCVLNNPGNVNGNCVDGGIGICCVDDTCAIHRRCD |
| Sequence map | 25-05 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | The cysteine framework of the conopressin is C-C. |
| Pharmaceutical Use | NA
|