Primary information |
---|
ID | 13440 |
Uniprot ID | Q9GLC7 |
Description | Parathyroid hormone-related protein (PTH-rP) (PTHrP) [Cleaved into- Osteostatin] |
Organism | Oryctolagus cuniculus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Lagomorpha; Leporidae (rabbits and hares); Oryctolagus; Oryctolagus cuniculus (Rabbit) |
Subcellular Location | Cytoplasm |
Developmental Stage | NA |
Similarity | Belongs to the parathyroid hormone family. |
Tissue Specificity | NA |
Post Translational Modification | There are several secretory forms; including osteostatin; arising from endoproteolytic cleavage of the initial translation product. Each of these secretory forms is believed to have one or more of its |
Function | Neuroendocrine peptide which is a critical regulator of cellular and organ growth; development; migration; differentiation and survival and of epithelial calcium ion transport. Regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. Required for skeletal homeostasis. Promotes mammary mesenchyme differentiation and bud outgrowth by modulating mesenchymal cell responsiveness to BMPs. Upregulates BMPR1A expression in the mammary mesenchyme and this increases the sensitivity of these cells to BMPs and allows them to respond to BMP4 in a paracrine and/or autocrine fashion. BMP4 signaling in the mesenchyme; in turn; triggers epithelial outgrowth and augments MSX2 expression; which causes the mammary mesenchyme to inhibit hair follicle formation within the nipple sheath. |
Length | 177 |
Molecular Weight | 20 |
Name | Parathyroid hormone-related protein |
Sequence | VSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPAANTKNHAVRFGSDDEGRYLTQETNKVEPYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWPLSAGAGSGLAGDHLSDISEPEPELDSRRH |
Sequence map | 39-57 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|