| Primary information |
|---|
| ID | 13434 |
| Uniprot ID | P06580 |
| Description | Prepro-urotensin II-gamma [Cleaved into- Urophysin gamma; Urotensin II-gamma (U-II-gamma) (UII-gamma)] |
| Organism | Cyprinus carpio |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Otomorpha; Ostariophysi; Otophysi; Cypriniphysae; Cypriniformes (carps and others); Cyprinoidei; Cyprinidae; Cyprininae; Cyprinus; Cyprinus carpio (Common carp) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the urotensin-2 family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Urotensin is found in the teleost caudal neurosecretory system. It has a suggested role in osmoregulation and as a corticotropin-releasing factor. The non-hormonal portion of this precursor may be a urotensin binding protein; urophysin. |
| Length | 125 |
| Molecular Weight | 13 |
| Name | Urophysin gamma |
| Sequence | PVTDTADMTYSGPDSVEEAGGVNPDDFSVSDLNEHLQRAAVAGYSPLFSQENIKVPGQIPKEALRELLLEKPYRLIPPRGLWGS |
| Sequence map | 23-46 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|