Primary information |
---|
ID | 13434 |
Uniprot ID | P06580 |
Description | Prepro-urotensin II-gamma [Cleaved into- Urophysin gamma; Urotensin II-gamma (U-II-gamma) (UII-gamma)] |
Organism | Cyprinus carpio |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Otomorpha; Ostariophysi; Otophysi; Cypriniphysae; Cypriniformes (carps and others); Cyprinoidei; Cyprinidae; Cyprininae; Cyprinus; Cyprinus carpio (Common carp) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the urotensin-2 family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Urotensin is found in the teleost caudal neurosecretory system. It has a suggested role in osmoregulation and as a corticotropin-releasing factor. The non-hormonal portion of this precursor may be a urotensin binding protein; urophysin. |
Length | 125 |
Molecular Weight | 13 |
Name | Urophysin gamma |
Sequence | PVTDTADMTYSGPDSVEEAGGVNPDDFSVSDLNEHLQRAAVAGYSPLFSQENIKVPGQIPKEALRELLLEKPYRLIPPRGLWGS |
Sequence map | 23-46 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|