| Primary information |
|---|
| ID | 13431 |
| Uniprot ID | O93448 |
| Description | UI [Cleaved into- Urophysin; Urotensin-1 (Urotensin I)] |
| Organism | Oncorhynchus mykiss |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Euteleosteomorpha; Protacanthopterygii; Salmoniformes (salmons and trouts); Salmonidae (salmonids); Salmoninae (trouts; salmons & chars); Oncorhynchus; Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Urotensin is found in the teleost caudal neurosecretory system. It has a suggested role in osmoregulation and as a corticotropin-releasing factor. The non-hormonal portion of this precursor may be a urotensin binding protein; urophysin. |
| Length | 165 |
| Molecular Weight | 18 |
| Name | Urophysin |
| Sequence | PPSVCRPRDLAMFDGHGYKSQLDEVLLKAGDNAISYLIGEKILRYLQRNPRLQAGLPPQFPFEVTPLGSRGLGHLARSLPPLEEQRAPEEGNSLEEFVELT |
| Sequence map | 21 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|