| Primary information |
|---|
| ID | 13428 |
| Uniprot ID | P04004 |
| Description | Vitronectin (VN) (S-protein) (Serum-spreading factor) (V75) [Cleaved into- Vitronectin V65 subunit; Vitronectin V10 subunit; Somatomedin-B] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted; extracellular space |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Expressed in the retina pigment epithelium (at protein level) (PubMed-25136834). Expressed in plasma (at protein level) (PubMed-2448300). Expressed in serum (at protein level) (PubMed-29567995). |
| Post Translational Modification | Sulfated on tyrosine residues. |
| Function | Vitronectin is a cell adhesion and spreading factor found in serum and tissues. Vitronectin interact with glycosaminoglycans and proteoglycans. Is recognized by certain members of the integrin family and serves as a cell-to-substrate adhesion molecule. Inhibitor of the membrane-damaging effect of the terminal cytolytic complement pathway.; Somatomedin-B is a growth hormone-dependent serum factor with protease-inhibiting activity. |
| Length | 478 |
| Molecular Weight | 54 |
| Name | Vitronectin |
| Sequence | QESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL |
| Sequence map | 27-58 |
| PDB ID | 1OC0; 1S4G; 1SSU; 2JQ8; 3BT1; 3BT2; 4K24; 6O5E; |
| Drugpedia | DB00054;DB09130;DB01593;DB14487;DB14533;DB14548; |
| Receptor | P06756 |
| Domain | The SMB domain mediates interaction with SERPINE1/ |
| Pharmaceutical Use | NA
|