| Primary information |
|---|
| ID | 13425 |
| Uniprot ID | A0A077DF94 |
| Description | Spexin prohormone 2 [Cleaved into- Spexin-2] (Fragment) |
| Organism | Danio rerio |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Otomorpha; Ostariophysi; Otophysi; Cypriniphysae; Cypriniformes (carps and others); Cyprinoidei; Danionidae; Danioninae; Danio; Danio rerio (Zebrafish) (Brachydanio rerio) |
| Subcellular Location | Secreted |
| Developmental Stage | Expressed throughout embryogenesis; from the 1 cell stage to 48 hours post fertilization (hpf); with the highest levels of expression at the 1 cell stage (PubMed-30903017). In larvae 7 days post ferti |
| Similarity | Belongs to the spexin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | [Spexin-2]- Acts as a ligand for galanin receptors galr2a and galr2b. |
| Length | 70 |
| Molecular Weight | 8 |
| Name | Spexin prohormone 2 |
| Sequence | QKSSLSKNWGPQSMLYLKGKHGRRFVPDIDDHFISNSGLKSWYAVFK |
| Sequence map | 24-10 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|