Primary information |
---|
ID | 13422 |
Uniprot ID | D3Z752 |
Description | Spexin (NPQ) (Neuropeptide Q) (Spexin hormone) [Cleaved into- Spexin-1; Spexin-2] |
Organism | Mus musculus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the spexin family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Plays a role as a central modulator of cardiovascular and renal function and nociception. Plays also a role in energy metabolism and storage. Inhibits adrenocortical cell proliferation with minor stimulation on corticosteroid release. |
Length | 116 |
Molecular Weight | 13 |
Name | Spexin |
Sequence | PQRLSEKRNWTPQAMLYLKGAQGRRFLSDQSRRKELADRPPPERRNPDLELLTLPEAAALFLASLEKSQKDEGGNFDKSELLEDRLFNW |
Sequence map | 28-56 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|