Primary information |
---|
ID | 13421 |
Uniprot ID | Q6UW15 |
Description | Regenerating islet-derived protein 3-gamma (REG-3-gamma) (Pancreatitis-associated protein 1B) (PAP-1B) (Pancreatitis-associated protein IB) (PAP IB) (Regenerating islet-derived protein III-gamma) (REG III) (Reg III-gamma) [Cleaved into- Regenerating islet-derived protein 3-gamma 16.5 kDa form; Regen |
Organism | Homo sapiens |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
Subcellular Location | Secreted Cytoplasm |
Developmental Stage | NA |
Similarity | NA |
Tissue Specificity | Predominantly expressed in pancreas; where it may be restricted to exocrine pancreas. Moderate expression levels in testis and weak in heart; kidney and placenta. |
Post Translational Modification | Proteolytic processing by trypsin removes an inhibitory N-terminal propeptide and is essential for peptidoglycan binding and antibacterial activity. |
Function | Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity; whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury. |
Length | 175 |
Molecular Weight | 19 |
Name | Regenerating islet-derived protein 3-gamma 16.5 kDa form |
Sequence | ETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD |
Sequence map | 29-55 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | The EPN motif is essential for recognition of the |
Pharmaceutical Use | NA
|