| Primary information |
|---|
| ID | 13419 |
| Uniprot ID | P35231 |
| Description | Regenerating islet-derived protein 3-alpha (REG-3-alpha) |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Low expression found in healthy pancreas. |
| Post Translational Modification | Proteolytic processing by trypsin removes an inhibitory N-terminal propeptide and is essential for its antibacterial activity. |
| Function | Bactericidal C-type lectin. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway. |
| Length | 174 |
| Molecular Weight | 19 |
| Name | Regenerating islet-derived protein 3-alpha 16.5 kDa form |
| Sequence | DSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSWFQADLACQKRPSGHLVSILSGGEASFVSSLVTGRVNNNQDIWIWLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVELPFVCKFKQ |
| Sequence map | 28-54 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | Lacks the EPN motif and the presence of Gln instea |
| Pharmaceutical Use | NA
|