| Primary information |
|---|
| ID | 13417 |
| Uniprot ID | P35230 |
| Description | Regenerating islet-derived protein 3-beta (REG-3-beta) (Pancreatitis-associated protein 1) |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted Note=Found in the apical region of pancreatic acinar cells. |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Constitutively expressed in the small intestine; moderately in colon and at an extremely low level in healthy pancreas. |
| Post Translational Modification | Proteolytic processing by trypsin removes an inhibitory N-terminal propeptide and is essential for peptidoglycan binding and antibacterial activity. |
| Function | Bactericidal C-type lectin which acts against several intestinal Gram-positive and Gram-negative bacteria. Lacks antibacterial activity against S.typhimurium. May play a role in protection against infection with S.enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues. |
| Length | 175 |
| Molecular Weight | 19 |
| Name | Regenerating islet-derived protein 3-beta 16.5 kDa form |
| Sequence | DSLKNIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPGGHLVSVLNSAEASFLSSMVKRTGNSYQYTWIGLHDPTLGAEPNGGGWEWSNNDVMNYFNWERNPSTALDRAFCGSLSRASGFLKWRDMTCEVKLPYVCKFTG |
| Sequence map | 29-55 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | The EPN motif is essential for recognition of the |
| Pharmaceutical Use | NA
|