| Primary information |
|---|
| ID | 13414 |
| Uniprot ID | Q9BT56 |
| Description | Spexin (NPQ) (Neuropeptide Q) (Spexin hormone) [Cleaved into- Spexin-1; Spexin-2 (NPQ 53-70)] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted Secreted; extracellular space. Cytoplasmic vesicle; secretory vesicle. Note=Secreted via th |
| Developmental Stage | NA |
| Similarity | Belongs to the spexin family. |
| Tissue Specificity | Expressed in the type I glomic cells within the carotid body (at protein level). Expressed predominantly in pancreas; testis; kidney; brain and placenta. Expressed in submucosal layer of esophagus and |
| Post Translational Modification | NA |
| Function | Plays a role as a central modulator of cardiovascular and renal function and nociception. Plays also a role in energy metabolism and storage. Inhibits adrenocortical cell proliferation with minor stimulation on corticosteroid release. |
| Length | 116 |
| Molecular Weight | 13 |
| Name | Spexin |
| Sequence | PQRLLERRNWTPQAMLYLKGAQGRRFISDQSRRKDLSDRPLPERRSPNPQLLTIPEAATILLASLQKSPEDEEKNFDQTRFLEDSLLNW |
| Sequence map | 28-56 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|