Primary information |
---|
ID | 13413 |
Uniprot ID | M0R8L2 |
Description | Spexin (Liver regeneration-related protein LRRGT00060) (NPQ) (Neuropeptide Q) (Spexin hormone) [Cleaved into- Spexin-1; Spexin-2 (NPQ 53-70)] |
Organism | Rattus norvegicus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the spexin family. |
Tissue Specificity | Widely expressed; predominantly expressed in epithelial cells in the skin; respiratory; digestive; urinary and reproductive systems; retina; adrenal gland and various brain regions. In the adrenal gla |
Post Translational Modification | NA |
Function | Plays a role as a central modulator of cardiovascular and renal function and nociception. Plays also a role in energy metabolism and storage. Inhibits adrenocortical cell proliferation with minor stimulation on corticosteroid release |
Length | 116 |
Molecular Weight | 13 |
Name | Spexin |
Sequence | PQRLSEKRNWTPQAMLYLKGAQGHRFISDQSRRKELADRPPPERRNPNLQLLTLPEAAALFLASLEKPQKDEGGDFDKSKLLEDRRFYW |
Sequence map | 28-56 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|