| Primary information |
|---|
| ID | 13412 |
| Uniprot ID | F1QQI2 |
| Description | Spexin prohormone 1 (Neuropeptide Q) (Spexin hormone) [Cleaved into- Spexin-1 (Spexin-14)] |
| Organism | Danio rerio |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Otomorpha; Ostariophysi; Otophysi; Cypriniphysae; Cypriniformes (carps and others); Cyprinoidei; Danionidae; Danioninae; Danio; Danio rerio (Zebrafish) (Brachydanio rerio) |
| Subcellular Location | [Spexin-1]- Secreted |
| Developmental Stage | In embryos; first detected at the 1 cell stage but disappears by the 2 cell stage (PubMed-30903017). Expressed again from 24 hours post fertilization (hpf) (PubMed-30903017). At 24 hours post fertiliz |
| Similarity | Belongs to the spexin family. |
| Tissue Specificity | Mainly expressed in the brain and ovary (PubMed-23623870; PubMed-24517231). Detected bilaterally in the adult brainstem (PubMed-30903017). Expressed in neurons in the dorsal habenula (dHb) (PubMed-314 |
| Post Translational Modification | NA |
| Function | Plays a role in the regulation of food intake and energy metabolism |
| Length | 102 |
| Molecular Weight | 11 |
| Name | Spexin prohormone 1 |
| Sequence | PKGSFQRRNWTPQAMLYLKGTQGRRFVSEDRNEGDLYDTIRLESRSQNTENLSISKAAAFLLNILQQARDEDEPY |
| Sequence map | 28-42 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|