Primary information |
---|
ID | 13409 |
Uniprot ID | O46540 |
Description | Natriuretic peptides A (Atrial natriuretic factor prohormone) (preproANF) |
Organism | Ovis aries |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Caprinae; Ovis; Ovis aries (Sheep) |
Subcellular Location | [Long-acting natriuretic peptide]- Secreted |
Developmental Stage | NA |
Similarity | Belongs to the natriuretic peptide family. |
Tissue Specificity | NA |
Post Translational Modification | The precursor molecule is proteolytically cleaved by CORIN at Arg-122 to produce the atrial natriuretic peptide. Undergoes further proteolytic cleavage by unknown proteases to give rise to long-acting |
Function | [Atrial natriuretic peptide]- Hormone that plays a key role in mediating cardio-renal homeostasis; and is involved in vascular remodeling and regulating energy metabolism. Acts by specifically binding and stimulating NPR1 to produce cGMP; which in turn activates effector proteins; such as PRKG1; that drive various biological responses. Regulates vasodilation; natriuresis; diuresis and aldosterone synthesis and is therefore essential for regulating blood pressure; controlling the extracellular fluid volume and maintaining the fluid-electrolyte balance. Also involved in inhibiting cardiac remodeling and cardiac hypertrophy by inducing cardiomyocyte apoptosis and attenuating the growth of cardiomyocytes and fibroblasts. Plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus; and thus prevents pregnancy-induced hypertension. In adipose tissue; acts in various cGMP- and PKG-dependent pathways to regulate lipid metabolism and energy homeosta |
Length | 152 |
Molecular Weight | 16 |
Name | Natriuretic peptides A |
Sequence | PVYGSVSNADLMDFKNLLDRLEDKMPLEDEAVPSQVLSEQNEEAGAPLSPLSEVPPWDGGRSTQPREMGAPSDGDPGNPPRSVLLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY |
Sequence map | 27-30 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|