| Primary information |
|---|
| ID | 13407 |
| Uniprot ID | Q9GLD0 |
| Description | Natriuretic peptides A (Atrial natriuretic factor prohormone) |
| Organism | Felis catus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Carnivora; Feliformia; Felidae (cat family); Felinae; Felis; Felis catus (Cat) (Felis silvestris catus) |
| Subcellular Location | [Long-acting natriuretic peptide]- Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the natriuretic peptide family. |
| Tissue Specificity | NA |
| Post Translational Modification | The precursor molecule is proteolytically cleaved by CORIN at Arg-123 to produce the atrial natriuretic peptide. Undergoes further proteolytic cleavage by unknown proteases to give rise to long-acting |
| Function | [Atrial natriuretic peptide]- Hormone that plays a key role in mediating cardio-renal homeostasis; and is involved in vascular remodeling and regulating energy metabolism. Acts by specifically binding and stimulating NPR1 to produce cGMP; which in turn activates effector proteins; such as PRKG1; that drive various biological responses. Regulates vasodilation; natriuresis; diuresis and aldosterone synthesis and is therefore essential for regulating blood pressure; controlling the extracellular fluid volume and maintaining the fluid-electrolyte balance. Also involved in inhibiting cardiac remodeling and cardiac hypertrophy by inducing cardiomyocyte apoptosis and attenuating the growth of cardiomyocytes and fibroblasts. Plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus; and thus prevents pregnancy-induced hypertension. In adipose tissue; acts in various cGMP- and PKG-dependent pathways to regulate lipid metabolism and energy homeosta |
| Length | 153 |
| Molecular Weight | 16 |
| Name | Natriuretic peptides A |
| Sequence | PVYGSVSNADLMDFKNLLDHLEDKMPLEDEVVPPQVLSEQNEEAGAALSPLPEVPPWAGEVNPAQRDGGALGRGSWDSSDRSALLKSKLRALLAAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY |
| Sequence map | 28-31 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|