| Primary information |
|---|
| ID | 13405 |
| Uniprot ID | P24259 |
| Description | Natriuretic peptides A |
| Organism | Sus scrofa |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Suina; Suidae (pigs); Sus; Sus scrofa (Pig) |
| Subcellular Location | [Long-acting natriuretic peptide]- Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the natriuretic peptide family. |
| Tissue Specificity | [Atrial natriuretic peptide]- Brain (at protein level). |
| Post Translational Modification | The precursor molecule is proteolytically cleaved by CORIN at Arg-122 to produce the atrial natriuretic peptide. Undergoes further proteolytic cleavage by unknown proteases to give rise to long-acting |
| Function | [Atrial natriuretic peptide]- Hormone that plays a key role in mediating cardio-renal homeostasis; and is involved in vascular remodeling and regulating energy metabolism. Acts by specifically binding and stimulating NPR1 to produce cGMP; which in turn activates effector proteins; such as PRKG1; that drive various biological responses. Regulates vasodilation; natriuresis; diuresis and aldosterone synthesis and is therefore essential for regulating blood pressure; controlling the extracellular fluid volume and maintaining the fluid-electrolyte balance |
| Length | 150 |
| Molecular Weight | 16 |
| Name | Natriuretic peptides A |
| Sequence | PVYGSVSNADLMDFKNLLDHLEDKMPLEDEAMPPQVLSEQNEEVGAPLSPLLEVPPWTGEVNPAQRDGGALGRGPWDASDRSALLKSKLRALLAAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY |
| Sequence map | 27-30 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|