| Primary information |
|---|
| ID | 13402 |
| Uniprot ID | P01210 |
| Description | Proenkephalin-A [Cleaved into- Synenkephalin; Met-enkephalin (Opioid growth factor) (OGF); PENK(114-133); PENK(143-183); Met-enkephalin-Arg-Gly-Leu; Leu-enkephalin; PENK(237-258); Met-enkephalin-Arg-Phe] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Cytoplasmic vesicle; secretory vesicle; chromaffin granule lumen |
| Developmental Stage | NA |
| Similarity | Belongs to the opioid neuropeptide precursor family. |
| Tissue Specificity | NA |
| Post Translational Modification | The N-terminal domain contains 6 conserved cysteines thought to be involved in disulfide bonding and/or processing.; Proenkephalin-A is cleaved by CTSL to generate Met-enkephalin. |
| Function | [Met-enkephalin]- Competes with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions; including pain perception and responses to stress.; [Leu-enkephalin]- Competes with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions; including pain perception and responses to stress.; [PENK(114-133)]- Increases glutamate release in the striatum and decreases GABA concentration in the striatum. |
| Length | 267 |
| Molecular Weight | 30 |
| Name | Proenkephalin-A |
| Sequence | ECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQLSKPELPQDGTSTLRENSKPEESHLLA |
| Sequence map | 1752 |
| PDB ID | 7057924; 6281660; 14702039; 15489334; 9126357 |
| Drugpedia | 1PLW;1PLX;2LWC;5E33;5E3A; |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|