Primary information |
---|
ID | 13378 |
Uniprot ID | P33689 |
Description | Pro-neuropeptide Y [Cleaved into- Neuropeptide Y (Neuropeptide tyrosine) (NPY); C-flanking peptide of NPY (CPON)] |
Organism | Xenopus laevis |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus; Xenopus laevis (African clawed frog) |
Subcellular Location | Secreted Cytoplasmic vesicle; secretory vesicle; neuronal dense core vesicle |
Developmental Stage | NA |
Similarity | Belongs to the NPY family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone. |
Length | 97 |
Molecular Weight | 11 |
Name | Pro-neuropeptide Y |
Sequence | SSPETMLSDVWWRENTENIPRSRFEDPPMW |
Sequence map | 720 |
PDB ID | 8439344; 9397931; |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|