| Primary information |
|---|
| ID | 13374 |
| Uniprot ID | P57774 |
| Description | Pro-neuropeptide Y [Cleaved into- Neuropeptide Y (Neuropeptide tyrosine) (NPY); C-flanking peptide of NPY (CPON)] |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted Cytoplasmic vesicle; secretory vesicle; neuronal dense core vesicle |
| Developmental Stage | NA |
| Similarity | Belongs to the NPY family. |
| Tissue Specificity | One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla. |
| Post Translational Modification | The neuropeptide Y form is cleaved at Pro-30 by the prolyl endopeptidase FAP (seprase) activity (in vitro). |
| Function | NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone. |
| Length | 97 |
| Molecular Weight | 10 |
| Name | Pro-neuropeptide Y |
| Sequence | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
| Sequence map | 864 |
| PDB ID | 16141072; 15489334; 11210195; 16452087; 21183079 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|