| Primary information |
|---|
| ID | 13366 |
| Uniprot ID | O35417 |
| Description | Proenkephalin-B (Beta-neoendorphin-dynorphin) (Preprodynorphin) [Cleaved into- Alpha-neoendorphin; Beta-neoendorphin; Big dynorphin (Big Dyn); Dynorphin A(1-17) (Dyn-A17) (Dynorphin A); Dynorphin A(1-13); Dynorphin A(1-8); Leu-enkephalin; Rimorphin (Dynorphin B) (Dyn-B) (Dynorphin B(1-13)); Leumorph |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the opioid neuropeptide precursor family. |
| Tissue Specificity | NA |
| Post Translational Modification | The N-terminal domain contains 6 conserved cysteines thought to be involved in disulfide bonding and/or processing. |
| Function | Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions; including pain perception and responses to stress. |
| Length | 248 |
| Molecular Weight | 28 |
| Name | Proenkephalin-B |
| Sequence | YGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVT |
| Sequence map | 768 |
| PDB ID | 9751516; 2409273; 16292317 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|