Primary information |
---|
ID | 13360 |
Uniprot ID | O46617 |
Description | Promotilin [Cleaved into- Motilin; Motilin-associated peptide (MAP)] (Fragment) |
Organism | Equus caballus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Perissodactyla (odd-toed ungulates); Equidae (horses); Equus; Equus; Equus caballus (Horse) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the motilin family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle. |
Length | 92 |
Molecular Weight | 10 |
Name | Promotilin |
Sequence | SLGLQQRSEEVGSLDPTEAAEEEGKEVIKLTAPVEIGMRMNSRQLEKYRAALEGLLSEVLLSTQNAAK |
Sequence map | 1632 |
PDB ID | 10564829 |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|