| Primary information |
|---|
| ID | 13358 |
| Uniprot ID | O46617 |
| Description | Promotilin [Cleaved into- Motilin; Motilin-associated peptide (MAP)] (Fragment) |
| Organism | Equus caballus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Perissodactyla (odd-toed ungulates); Equidae (horses); Equus; Equus; Equus caballus (Horse) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the motilin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle. |
| Length | 92 |
| Molecular Weight | 10 |
| Name | Promotilin |
| Sequence | FVPIFTYSELQRMQEKERNRGQKKSLGLQQRSEEVGSLDPTEAAEEEGKEVIKLTAPVEIGMRMNSRQLEKYRAALEGLLSEVLLSTQNAAK |
| Sequence map | 2208 |
| PDB ID | 10564829 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|