| Primary information |
|---|
| ID | 13353 |
| Uniprot ID | Q27441 |
| Description | Pro-neuropeptide Y [Cleaved into- Neuropeptide Y (Neuropeptide tyrosine) (NPY); C-flanking peptide of NPY (CPON)] |
| Organism | Aplysia californica |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Spiralia; Lophotrochozoa; Mollusca; Gastropoda; Heterobranchia; Euthyneura; Tectipleura; Aplysiida (sea hares); Aplysioidea; Aplysiidae; Aplysia; Aplysia californica (California sea hare) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the NPY family. |
| Tissue Specificity | Highly expressed in the abdominal ganglion; to lesser extent in the pleural-pedal ganglion and much lower in the cerebral ganglion. |
| Post Translational Modification | NA |
| Function | May play a role in the regulation of viscermotor functions during egg laying. |
| Length | 92 |
| Molecular Weight | 10 |
| Name | Pro-neuropeptide Y |
| Sequence | DNSEMLAPPPRPEEFTSAQQLRQYLAALNEYYSIMGRPRF |
| Sequence map | 960 |
| PDB ID | 1524828 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|