Primary information |
---|
ID | 13351 |
Uniprot ID | O18811 |
Description | Promotilin [Cleaved into- Motilin; Motilin-associated peptide (MAP)] |
Organism | Macaca mulatta |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Cercopithecoidea; Cercopithecidae (Old World monkeys); Cercopithecinae; Macaca (macaques); Macaca mulatta (Rhesus macaque) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the motilin family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle. |
Length | 115 |
Molecular Weight | 12 |
Name | Promotilin |
Sequence | FVPIFTYGELQRMQEKERSKGQKKSLSVWQRSGEEGPVDPAEPIEEEGNEMIKLTAPLEIGMRMNSRQLEKYRAALEGLLSEMLPQHAAK |
Sequence map | 2160 |
PDB ID | 9762897 |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|