| Primary information |
|---|
| ID | 13327 |
| Uniprot ID | P41535 |
| Description | Pituitary adenylate cyclase-activating polypeptide (PACAP) [Cleaved into- PACAP-related peptide (PRP-48); Pituitary adenylate cyclase-activating polypeptide 27 (PACAP-27) (PACAP27); Pituitary adenylate cyclase-activating polypeptide 38 (PACAP-38) (PACAP38)] |
| Organism | Sus scrofa |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Suina; Suidae (pigs); Sus; Sus scrofa (Pig) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Binding to its receptor activates G proteins and stimulates adenylate cyclase in pituitary cells. Promotes neuron projection development through the RAPGEF2/Rap1/B-Raf/ERK pathway. In chromaffin cells; induces long-lasting increase of intracellular calcium concentrations and neuroendocrine secretion. Involved in the control of glucose homeostasis; induces insulin secretion by pancreatic beta cells. |
| Length | 176 |
| Molecular Weight | 19 |
| Name | Pituitary adenylate cyclase-activating polypeptide |
| Sequence | HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK |
| Sequence map | 912 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q28993 |
| Domain | NA |
| Pharmaceutical Use | NA
|