Primary information |
---|
ID | 13326 |
Uniprot ID | P41535 |
Description | Pituitary adenylate cyclase-activating polypeptide (PACAP) [Cleaved into- PACAP-related peptide (PRP-48); Pituitary adenylate cyclase-activating polypeptide 27 (PACAP-27) (PACAP27); Pituitary adenylate cyclase-activating polypeptide 38 (PACAP-38) (PACAP38)] |
Organism | Sus scrofa |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Suina; Suidae (pigs); Sus; Sus scrofa (Pig) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Binding to its receptor activates G proteins and stimulates adenylate cyclase in pituitary cells. Promotes neuron projection development through the RAPGEF2/Rap1/B-Raf/ERK pathway. In chromaffin cells; induces long-lasting increase of intracellular calcium concentrations and neuroendocrine secretion. Involved in the control of glucose homeostasis; induces insulin secretion by pancreatic beta cells. |
Length | 176 |
Molecular Weight | 19 |
Name | Pituitary adenylate cyclase-activating polypeptide |
Sequence | DVAHGILNKAYRKVLDQLSARKYLQTLMAKSVGGNLDGGAEDDSEPLS |
Sequence map | 1152 |
PDB ID | NA |
Drugpedia | NA |
Receptor | Q28992 |
Domain | NA |
Pharmaceutical Use | NA
|