| Primary information |
|---|
| ID | 13321 |
| Uniprot ID | C0HJI7 |
| Description | Insulin-1 [Cleaved into- Insulin-1 B chain; Insulin-1 A chain] |
| Organism | Huso dauricus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Chondrostei; Acipenseriformes (sturgeons and paddlefish); Acipenseroidei; Acipenseridae (sturgeons); Husinae; Huso; Huso dauricus (Kaluga sturgeon) (Acipenser dauricus) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides; amino acids and fatty acids. It accelerates glycolysis; the pentose phosphate cycle; and glycogen synthesis in liver. |
| Length | 58 |
| Molecular Weight | 6 |
| Name | Insulin-1 |
| Sequence | HVSKAAANQHLWCGAHLVEALYLVCGERGFFYTPNK |
| Sequence map | 864 |
| PDB ID | 11150638 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|