| Primary information |
|---|
| ID | 13317 |
| Uniprot ID | P41694 |
| Description | Insulin-like growth factor II (IGF-II) [Cleaved into- Insulin-like growth factor II; Preptin] (Fragment) |
| Organism | Neovison vison |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Carnivora; Caniformia; Mustelidae (weasel; mink; badger; martens and others); Mustelinae; Neovison; Neovison vison (American mink) (Mustela vison) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | NA |
| Post Translational Modification | Proteolytically processed by PCSK4; proIGF2 is cleaved at Arg-129 and Arg-92 to generate big-IGF2 and mature IGF2. |
| Function | The insulin-like growth factors possess growth-promoting activity. Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF2 is influenced by placental lactogen. Also involved in tissue differentiation. In adults; involved in glucose metabolism in adipose tissue; skeletal muscle and liver. Acts as a ligand for integrin which is required for IGF2 signaling. Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators; thereby controlling muscle terminal differentiation. Inhibits myoblast differentiation and modulates metabolism via increasing the mitochondrial respiration rate. |
| Length | 129 |
| Molecular Weight | 14 |
| Name | Insulin-like growth factor II |
| Sequence | AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSSRGIVEECCFRSCDLALLETYCATPAKSE |
| Sequence map | 1632 |
| PDB ID | 7686523 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|