| Primary information |
|---|
| ID | 13314 |
| Uniprot ID | Q15726 |
| Description | Metastasis-suppressor KiSS-1 (Kisspeptin-1) [Cleaved into- Metastin (Kisspeptin-54); Kisspeptin-14; Kisspeptin-13; Kisspeptin-10] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the KISS1 family. |
| Tissue Specificity | Very high expression in placenta; with the next highest level in testis and moderate levels in pancreas; liver; small intestine and brain at much lower levels. Expression levels increased in both earl |
| Post Translational Modification | Processed by MMP2 and MMP9. |
| Function | Metastasis suppressor protein in malignant melanomas and in some breast cancers. May regulate events downstream of cell-matrix adhesion; perhaps involving cytoskeletal reorganization. Generates a C-terminally amidated peptide; metastin which functions as the endogenous ligand of the G-protein coupled receptor GPR54. Activation of the receptor inhibits cell proliferation and cell migration; key characteristics of tumor metastasis. Kp-10 is a decapeptide derived from the primary translation product; isolated in conditioned medium of first trimester trophoblast. Kp-10; but not other kisspeptins; increased intracellular Ca(2+) levels in isolated first trimester trophoblasts. Kp-10 is a paracrine/endocrine regulator in fine-tuning trophoblast invasion generated by the trophoblast itself. The receptor is also essential for normal gonadotropin-released hormone physiology and for puberty. The hypothalamic KiSS1/GPR54 system is a pivotal factor in central regulation of the gonadotropic axis at |
| Length | 138 |
| Molecular Weight | 14 |
| Name | Metastasis-suppressor KiSS-1 |
| Sequence | GTSLSPPPESSGSPQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF |
| Sequence map | 1296 |
| PDB ID | 8944003; 9806840; 15498874; 14702039; 16710414; 15489334; 11385580; 9192814; 9185708; 11457 |
| Drugpedia | NA |
| Receptor | Q969F8; Q969F8 |
| Domain | NA |
| Pharmaceutical Use | NA
|