Primary information |
---|
ID | 13310 |
Uniprot ID | P01303 |
Description | Pro-neuropeptide Y [Cleaved into- Neuropeptide Y (Neuropeptide tyrosine) (NPY); C-flanking peptide of NPY (CPON)] |
Organism | Homo sapiens |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
Subcellular Location | Secreted Cytoplasmic vesicle; secretory vesicle; neuronal dense core vesicle |
Developmental Stage | NA |
Similarity | Belongs to the NPY family. |
Tissue Specificity | One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla. |
Post Translational Modification | The neuropeptide Y form is cleaved at Pro-30 by the prolyl endopeptidase FAP (seprase) activity (in vitro). |
Function | NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone. |
Length | 97 |
Molecular Weight | 10 |
Name | Pro-neuropeptide Y |
Sequence | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
Sequence map | 864 |
PDB ID | 6589611; 2427515; 3753985; 12853948; 15489334; 3839058; 21314817; 24275569; 1425680; 900835 |
Drugpedia | 1QFA;1RON; |
Receptor | P25929; P49146; P50391; Q15761 |
Domain | NA |
Pharmaceutical Use | NA
|