| Primary information |
|---|
| ID | 13302 |
| Uniprot ID | Q5PXH1 |
| Description | Metastasis-suppressor KiSS-1 (Kisspeptin-1) [Cleaved into- Metastin; Kisspeptin-10] (Fragment) |
| Organism | Macaca mulatta |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Cercopithecoidea; Cercopithecidae (Old World monkeys); Cercopithecinae; Macaca (macaques); Macaca mulatta (Rhesus macaque) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the KISS1 family. |
| Tissue Specificity | In the hypothalamus; expression increases with puberty in both male and female monkeys. Robust expression in the region of the arcuate nucleus (ARC). |
| Post Translational Modification | NA |
| Function | Metastasis suppressor protein. May regulate events downstream of cell-matrix adhesion; perhaps involving cytoskeletal reorganization. Generates a C-terminally amidated peptide; metastin which functions as the endogenous ligand of the G-protein coupled receptor GPR54. The receptor is essential for normal gonadotropin-released hormone physiology and for puberty. The hypothalamic KiSS1/GPR54 system is a pivotal factor in central regulation of the gonadotropic axis at puberty and in adulthood. |
| Length | 88 |
| Molecular Weight | 9 |
| Name | Metastasis-suppressor KiSS-1 |
| Sequence | GASLSSPAESSGSPQRRGLSAPSSRQIPAPQGAVLVQREKDLPNYNW |
| Sequence map | 1128 |
| PDB ID | 15684075 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|