Primary information |
---|
ID | 13299 |
Uniprot ID | P07808 |
Description | Pro-neuropeptide Y [Cleaved into- Neuropeptide Y (Neuropeptide tyrosine) (NPY); C-flanking peptide of NPY (CPON)] |
Organism | Rattus norvegicus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
Subcellular Location | Secreted Cytoplasmic vesicle; secretory vesicle; neuronal dense core vesicle |
Developmental Stage | NA |
Similarity | Belongs to the NPY family. |
Tissue Specificity | One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla. |
Post Translational Modification | The neuropeptide Y form is cleaved at Pro-31 by the prolyl endopeptidase FAP (seprase) activity (in vitro). |
Function | NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone. |
Length | 98 |
Molecular Weight | 11 |
Name | Pro-neuropeptide Y |
Sequence | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
Sequence map | 864 |
PDB ID | 3031687; 3031663; 2834371; 3413293; 29166604; 30021165 |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|