| Primary information |
|---|
| ID | 13296 |
| Uniprot ID | Q9JI85 |
| Description | Nucleobindin-2 (DNA-binding protein NEFA) (Prepronesfatin) [Cleaved into- Nesfatin-1] |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Golgi apparatus |
| Developmental Stage | NA |
| Similarity | Belongs to the nucleobindin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Calcium-binding protein which may have a role in calcium homeostasis. Acts as a non-receptor guanine nucleotide exchange factor which binds to and activates guanine nucleotide-binding protein (G-protein) alpha subunit GNAI3 |
| Length | 420 |
| Molecular Weight | 50 |
| Name | Nucleobindin-2 |
| Sequence | VPIDVDKTKVHNVEPVESARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDEL |
| Sequence map | 1968 |
| PDB ID | 15489334; 17036007; 21653697; 22293188; 22673903 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | The GBA (G-alpha binding and activating) motif med |
| Pharmaceutical Use | NA
|