| Primary information |
|---|
| ID | 13290 |
| Uniprot ID | P10631 |
| Description | Peptide YY (PYY) (Peptide tyrosine tyrosine) [Cleaved into- Peptide YY(3-36) (PYY-II)] |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the NPY family. |
| Tissue Specificity | NA |
| Post Translational Modification | The peptide YY form is cleaved at Pro-30 by the prolyl endopeptidase FAP (seprase) activity (in vitro) to generate peptide YY(3-36). |
| Function | This gut peptide inhibits exocrine pancreatic secretion; has a vasoconstrictory action and inhibitis jejunal and colonic mobility. |
| Length | 98 |
| Molecular Weight | 11 |
| Name | Peptide YY |
| Sequence | YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY |
| Sequence map | 864 |
| PDB ID | 3654598; 1890992; 3413293 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|