Primary information |
---|
ID | 13277 |
Uniprot ID | D2IT41 |
Description | Pigment-dispersing hormone peptides [Cleaved into- PDH precursor-related peptide (PPRP); Pigment-dispersing hormone (PDH)] |
Organism | Eurydice pulchra |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Crustacea; Multicrustacea; Malacostraca; Eumalacostraca; Peracarida; Isopoda (pill bugs; wood lice and sea slaters); Flabellifera; Cirolanidae; Eurydice; Eurydice pulchra (Speckled sea louse) |
Subcellular Location | Secreted |
Developmental Stage | Does not display circadian or circatidal patterns of expression. |
Similarity | Belongs to the arthropod PDH family. |
Tissue Specificity | Strongly expressed in eyestalk tissue and cerebral ganglia (at protein level). |
Post Translational Modification | NA |
Function | The pigment-dispersing hormone causes the migration of the distal retinal pigment into the proximal end of the pigment chromatophore cells and thus decreases the amount of light entering the retinulas. May also function as a neurotransmitter and/or neuromodulator. |
Length | 83 |
Molecular Weight | 9 |
Name | Pigment-dispersing hormone peptides |
Sequence | QSRDFSISEREIVASLAKQLLRVARMGYVPEGDLPR |
Sequence map | 864 |
PDB ID | 21192084 |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|